Product Name
Cytokeratin 1 (Krt1), Polyclonal Antibody
Full Product Name
Anti-Cytokeratin 1 Antibody
Product Synonym Names
Keratin; 67 kDa cytokeratin; CK-1; CK1; Cytokeratin-1; Cytokeratin1; EHK; EHK1; Epidermolytic hyperkeratosis 1; EPPK; Hair alpha protein; K1; K2C1_HUMAN; Keratin; Keratin type II cytoskeletal 1; Keratin-1; Keratin1; KRT 1; Krt1; KRT1A; NEPPK; type II cytoskeletal 1; Type II keratin Kb1; Type-II keratin Kb1; keratin 1, type II
Product Gene Name
anti-Krt1 antibody
[Similar Products]
Research Use Only
For Research Use Only. Not for use in diagnostic procedures.
3D Structure
ModBase 3D Structure for P04104
Species Reactivity
Human, Mouse, Rat
Purity/Purification
Immunogen Affinity Purified
Form/Format
Lyophilized. Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Immunogen
A synthetic peptide corresponding to a sequence at the N-terminus of mouse Cytokeratin 1 (223-257aa LQQVDTTTRTQNLDPFFENYISILRRKVDSLKSD Q), different from the related human sequence by ten amino acids, and from the related rat sequence by five amino acids.
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Preparation and Storage
At -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquoted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.
ISO Certification
Manufactured in an ISO 13485:2003 and EN ISO 13485:2012 Certified Laboratory.
Other Notes
Small volumes of anti-Krt1 antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.
Related Product Information for
anti-Krt1 antibody
Description: Rabbit IgG polyclonal antibody for Keratin, type II cytoskeletal 1(KRT1) detection. Tested with WB, IHC-P in Human;Mouse;Rat.
Background: Keratin 1 (KRT1), also known as Cytokeratin 1, or Keratin, type II cytoskeletal 1, is a member of the keratin family. It is specifically expressed in the spinous and granular layers of the epidermis with family member keratin 10. Mutations in this gene have been associated with the variants ofbullous congenital ichthyosiform erythroderma in which the palms and soles of the feet are affected. The type II cytokeratins consist of basic or neutral proteins which are arranged in pairs of heterotypic keratin chains coexpressed during differentiation of simple and stratified epithelial tissues. And this type II cytokeratin is specifically expressed in the spinous and granular layers of the epidermis with family member KRT10 and mutations in these genes have been associated with bullous congenital ichthyosiform erythroderma. The type II cytokeratins are clustered in a region of chromosome 12q12-q13.
Applications Tested/Suitable for anti-Krt1 antibody
Western Blot (WB), Immunohistochemistry (IHC) Paraffin
Application Notes for anti-Krt1 antibody
Western Blot Concentration: 0.1-0.5ug/ml
Immunohistochemistry (IHC) Paraffin Concentration: 0.5-1ug/ml
Western Blot (WB) of anti-Krt1 antibody
Anti- Cytokeratin 1 Picoband antibody, MBS178145, Western blotting
All lanes: Anti Cytokeratin 1 (MBS178145) at 0.5ug/ml
Lane 1: Rat Liver Tissue Lysate at 50ug
Lane 2: Rat Skeletal Muscle Tissue Lysate at 50ug
Lane 3: Rat Spleen Tissue Lysate at 50ug
Lane 4: SKOV Whole Cell Lysate at 40ug
Lane 5: A431 Whole Cell Lysate at 40ug
Predicted bind size: 67KD
Observed bind size: 67KD

Immunohistochemistry (IHC) of anti-Krt1 antibody
Anti- Cytokeratin 1 Picoband antibody, MBS178145, IHC(P)
IHC(P): Rat Lung Tissue

Immunohistochemistry (IHC) of anti-Krt1 antibody
Anti- Cytokeratin 1 Picoband antibody, MBS178145, IHC(P)
IHC(P): Human Oesophagus Squama Cancer Tissue

Immunohistochemistry (IHC) of anti-Krt1 antibody
Anti- Cytokeratin 1 Picoband antibody, MBS178145, IHC(P)
IHC(P): Mouse Lung Tissue

NCBI/Uniprot data below describe general gene information for Krt1. It may not necessarily be applicable to this product.
NCBI Accession #
NP_032499.2
[Other Products]
NCBI GenBank Nucleotide #
NM_008473.2
[Other Products]
UniProt Primary Accession #
P04104
[Other Products]
UniProt Secondary Accession #
Q149E0; Q9D2K8[Other Products]
UniProt Related Accession #
P04104[Other Products]
Molecular Weight
65,606 Da[Similar Products]
NCBI Official Full Name
keratin, type II cytoskeletal 1
NCBI Official Synonym Full Names
keratin 1
NCBI Official Symbol
Krt1??[Similar Products]
NCBI Official Synonym Symbols
Krt86; Krt2-1; Krt-2.1
??[Similar Products]
NCBI Protein Information
keratin, type II cytoskeletal 1
UniProt Protein Name
Keratin, type II cytoskeletal 1
UniProt Synonym Protein Names
67 kDa cytokeratin; Cytokeratin-1; CK-1; Keratin-1; K1; Type-II keratin Kb1
UniProt Gene Name
Krt1??[Similar Products]
UniProt Synonym Gene Names
Krt2-1; CK-1; K1??[Similar Products]
UniProt Entry Name
K2C1_MOUSE
UniProt Comments for Krt1
K1: a type II cytoskeletal keratin. The keratins are intermediate filament proteins responsible for the structural integrity of epithelial cells and are subdivided into cytokeratins and hair keratins. There are two types of cytoskeletal and microfibrillar keratin: type I (acidic; 40-55 kDa) [K9 to K20] and type II (neutral to basic; 56-70 kDa) [K1 to K8]. Both a basic and an acidic keratin are required for filament assembly. Generally associates with K10.
Protein type: Cytoskeletal
Cellular Component: extracellular matrix; extracellular space; intermediate filament; keratin filament; membrane; nucleus; plasma membrane
Molecular Function: carbohydrate binding; structural molecule activity
Biological Process: complement activation, lectin pathway; negative regulation of inflammatory response
Product References and Citations for anti-Krt1 antibody
1. "Entrez Gene: KRT1 keratin 1 (epidermolytic hyperkeratosis)". 2. Whittock NV, Ashton GH, Griffiths WA et al. (2001). "New mutations in keratin 1 that cause bullous congenital ichthyosiform erythroderma and keratin 2e that cause ichthyosis bullosa of Siemens". Br. J. Dermatol. 145(2): 330-5.
Research Articles on Krt1
1. Absence of Krt1 caused a prenatal increase in interleukin-18 (IL-18) and the S100A8 and S100A9 proteins, accompanied by a barrier defect and perinatal lethality.
Precautions
All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.
Disclaimer
While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.
It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.