Full Product Name
Anti-ZP2 Antibody
Product Synonym Names
Zona pellucida sperm-binding protein 2; OTTHUMP00000115849; Processed zona pellucida sperm-binding protein 2; Zona pellucida glycoprotein 2; zona pellucida glycoprotein ZP2; Zona pellucida protein A; Zp-2; ZP2; ZP2_HUMAN; ZPA; zona pellucida glycoprotein 2 (sperm receptor)
Product Gene Name
anti-ZP2 antibody
[Similar Products]
Research Use Only
For Research Use Only. Not for use in diagnostic procedures.
3D Structure
ModBase 3D Structure for Q05996
Purity/Purification
Immunogen Affinity Purified
Form/Format
Lyophilized. Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Immunogen
A synthetic peptide corresponding to a sequence at the N-terminus of human ZP2 (511-544aa ENEYPLVRFLRQPIYMEVRVLNRDDPNIKLVLDD), different from the related mouse sequence by six amino acids, and from the related rat sequence by four amino acids.
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Preparation and Storage
At -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquoted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.
ISO Certification
Manufactured in an ISO 13485:2003 and EN ISO 13485:2012 Certified Laboratory.
Other Notes
Small volumes of anti-ZP2 antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.
Related Product Information for
anti-ZP2 antibody
Description: Rabbit IgG polyclonal antibody for Zona pellucida sperm-binding protein 2(ZP2) detection. Tested with WB, IHC-P in Human.
Background: Zona pellucida sperm-binding protein 2 is a protein that in humans is encoded by the ZP2 gene. The sperm-binding domain on the ZP2 protein is necessary in both humans and mice for oocyte-sperm recognition and penetration of the zona pellucida. It is also responsible for the primary block to polyspermy in mammals. The oocyte has cortical granules peripherally located under the cortex that contain a proteolytic protein called ovastacin. After the sperm binds to ZP2, the cortical granules are exocytosed releasing ovastacin into the perivitelline space. Ovastacin cleaves ZP2 at the N terminus, preventing more sperm from binding and penetrating the oocyte, thus hardening the zona pellucida. Ovastacin is only found in oocytes, and is part of the astacin family of metalloendoproteases. Female mice engineered without ovastacin showed that ZP2 was not cleaved after fertilization.
Applications Tested/Suitable for anti-ZP2 antibody
Western Blot (WB), Immunohistochemistry (IHC) Paraffin
Application Notes for anti-ZP2 antibody
Western Blot Concentration: 0.1-0.5ug/ml
Immunohistochemistry (IHC) Paraffin Concentration: 0.5-1ug/ml
Western Blot (WB) of anti-ZP2 antibody
Western blot analysis of ZP2 expression in HELA whole cell lysates (lane 1) and HEPG2 whole cell lysates (lane 2). ZP2 at 82KD was detected using rabbit anti- ZP2 Antigen Affinity purified polyclonal antibody at0.5 ug/mL. The blot was developed using chemiluminescence (ECL) method.

Immunohistochemistry (IHC) of anti-ZP2 antibody
ZP2 was detected in paraffin-embedded sections of human intestinal cancer tissues using rabbit anti- ZP2 Antigen Affinity purified polyclonal antibody at 1ug/mL. The immunohistochemical section was developed using SABC method.

Immunohistochemistry (IHC) of anti-ZP2 antibody
Figure 3. IHC analysis of ZP2 using anti-ZP2 antibody (MBS178234).
ZP2 was detected in frozen section of human placenta tissue. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1ug/ml rabbit anti-ZP2 Antibody (MBS178234) overnight at 4 degree C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37 degree C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) with DAB as the chromogen.

NCBI/Uniprot data below describe general gene information for ZP2. It may not necessarily be applicable to this product.
NCBI Accession #
NP_001277033.1
[Other Products]
NCBI GenBank Nucleotide #
NM_001290104.1
[Other Products]
UniProt Primary Accession #
Q05996
[Other Products]
UniProt Secondary Accession #
Q4VAN9; Q4VAP0; Q4VAP1; B2R7J2[Other Products]
UniProt Related Accession #
Q05996[Other Products]
Molecular Weight
81,300 Da
NCBI Official Full Name
zona pellucida sperm-binding protein 2 isoform 2 preproprotein
NCBI Official Synonym Full Names
zona pellucida glycoprotein 2
NCBI Official Symbol
ZP2??[Similar Products]
NCBI Official Synonym Symbols
ZPA; Zp-2
??[Similar Products]
NCBI Protein Information
zona pellucida sperm-binding protein 2
UniProt Protein Name
Zona pellucida sperm-binding protein 2
UniProt Synonym Protein Names
Zona pellucida glycoprotein 2; Zp-2
Protein Family
Zona pellucida sperm-binding protein
UniProt Gene Name
ZP2??[Similar Products]
UniProt Synonym Gene Names
ZPA; Zp-2??[Similar Products]
UniProt Entry Name
ZP2_HUMAN
NCBI Summary for ZP2
The zona pellucida is an extracellular matrix that surrounds the oocyte and early embryo. It is composed of three glycoproteins with various functions during fertilization and preimplantation development. The glycosylated mature peptide is one of the structural components of the zona pellucida and functions in secondary binding and penetration of acrosome-reacted spermatozoa. Female mice lacking this gene do not form a stable zona matrix and are sterile. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Feb 2014]
UniProt Comments for ZP2
ZP2: The mammalian zona pellucida, which mediates species- specific sperm binding, induction of the acrosome reaction and prevents post-fertilization polyspermy, is composed of three to four glycoproteins, ZP1, ZP2, ZP3, and ZP4. ZP2 may act as a secondary sperm receptor. Belongs to the ZP domain family. ZPA subfamily.
Protein type: Membrane protein, integral
Chromosomal Location of Human Ortholog: 16p12
Cellular Component: endoplasmic reticulum; extracellular matrix; extracellular region; Golgi apparatus; integral to membrane; multivesicular body; plasma membrane; proteinaceous extracellular matrix; secretory granule
Molecular Function: acrosin binding; coreceptor activity
Biological Process: binding of sperm to zona pellucida; intracellular protein transport; manganese ion transport; regulation of acrosome reaction; signal transduction
Product References and Citations for anti-ZP2 antibody
1. "Entrez Gene: ZP2 zona pellucida glycoprotein 2 (sperm receptor)". 2. Burkart AD, Xiong B, Baibakov B, Jiménez-Movilla M, Dean J. "Ovastacin, a cortical granule protease, cleaves ZP2 in the zona pellucida to prevent polyspermy.". J Cell Biol 197: 37-44. 3. Liang LF, Dean J (Apr 1993). "Conservation of mammalian secondary sperm receptor genes enables the promoter of the human gene to function in mouse oocytes". Dev Biol 156 (2): 399-408.
Research Articles on ZP2
1. ZP2(51-149) sperm-binding domain is necessary for human gamete recognition and penetration through the zona pellucida.
Precautions
All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.
Disclaimer
While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.
It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.