Product Name
Tachykinin 3 (TAC3), Polyclonal Antibody
Full Product Name
Tachykinin 3 antibody
Product Synonym Names
Polyclonal Tachykinin 3; Anti-Tachykinin 3; Tachykinin 3; Tachykinin -3; NKNB; Neuromedin K Neurokinin Beta; NKB; ZNEUROK1; PRO1155; TAC3
Product Gene Name
anti-TAC3 antibody
[Similar Products]
Research Use Only
For Research Use Only. Not for use in diagnostic procedures.
Purity/Purification
Affinity purified
Form/Format
Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of TAC3 antibody in PBS
Concentration
1 mg/ml (lot specific)
Biological Significance
Tachykinins are active peptides which excite neurons, evoke behavioral responses, are potent vasodilators and secretagogues, and contract (directly or indirectly) many smooth muscles.
Immunogen
Tachykinin 3 antibody was raised using a synthetic peptide corresponding to a region with amino acids RSKRDPDLYQLLQRLFKSHSSLEGLLKALSQASTDPKESTSPEKRDMHDF
Preparation and Storage
Store at 2-8 degree C for short periods. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Other Notes
Small volumes of anti-TAC3 antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.
Related Product Information for
anti-TAC3 antibody
Rabbit polyclonal Tachykinin 3 antibody
Product Categories/Family for anti-TAC3 antibody
Signal Transduction; Purified Polyclonal Antibodies
Applications Tested/Suitable for anti-TAC3 antibody
Western Blot (WB)
Application Notes for anti-TAC3 antibody
WB: 1 ug/ml
Western Blot (WB) of anti-TAC3 antibody
Tachykinin 3 antibody (MBS5301764) used at 1 ug/ml to detect target protein.
NCBI/Uniprot data below describe general gene information for TAC3. It may not necessarily be applicable to this product.
NCBI Accession #
AAH32145.1
[Other Products]
UniProt Secondary Accession #
Q6IAG2; Q71BC6; Q71BC9[Other Products]
UniProt Related Accession #
Q9UHF0[Other Products]
Molecular Weight
13 kDa (MW of target protein)[Similar Products]
NCBI Official Full Name
Tachykinin 3
NCBI Official Synonym Full Names
tachykinin 3
NCBI Official Symbol
TAC3??[Similar Products]
NCBI Official Synonym Symbols
NKB; HH10; NKNB; PRO1155; ZNEUROK1
??[Similar Products]
NCBI Protein Information
tachykinin-3
UniProt Protein Name
Tachykinin-3
UniProt Synonym Protein Names
ZNEUROK1
Protein Family
Tachykinin
UniProt Gene Name
TAC3??[Similar Products]
UniProt Synonym Gene Names
NKNB; NKB??[Similar Products]
UniProt Entry Name
TKNK_HUMAN
NCBI Summary for TAC3
This gene encodes a member of the tachykinin family of secreted neuropeptides. The encoded protein is primarily expressed in the central and peripheral nervous system and functions as a neurotransmitter. This protein is the ligand for the neurokinin-3 receptor. This protein is also expressed in the outer syncytiotrophoblast of the placenta and may be associated with pregnancy-induced hypertension and pre-eclampsia. Mutations in this gene are associated with normosmic hypogonadotropic hypogonadism. Alternate splicing results in multiple transcript variants. [provided by RefSeq, May 2010]
UniProt Comments for TAC3
TAC3: Tachykinins are active peptides which excite neurons, evoke behavioral responses, are potent vasodilators and secretagogues, and contract (directly or indirectly) many smooth muscles. Belongs to the tachykinin family. 3 isoforms of the human protein are produced by alternative splicing.
Protein type: Secreted; Secreted, signal peptide
Chromosomal Location of Human Ortholog: 12q13.3
Cellular Component: extracellular space; extracellular region
Molecular Function: protein binding; receptor binding
Biological Process: tachykinin signaling pathway; neuropeptide signaling pathway; female pregnancy
Disease: Hypogonadotropic Hypogonadism 10 With Or Without Anosmia
Research Articles on TAC3
1. SP may influence the KP and NKB secretory output via additional autocrine/paracrine mechanisms or regulate GnRH neurosecretion directly.
Precautions
All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.
Disclaimer
While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.
It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.
