Product Name
CACNB2, Polyclonal Antibody
Popular Item
Full Product Name
CACNB2 Polyclonal Antibody
Product Synonym Names
CACNB2; CACNLB2; CAVB2; MYSB; calcium voltage-gated channel auxiliary subunit beta 2
Product Gene Name
anti-CACNB2 antibody
[Similar Products]
Research Use Only
For Research Use Only. Not for use in diagnostic procedures.
3D Structure
ModBase 3D Structure for Q08289
Species Reactivity
Human, Mouse, Rat
Purity/Purification
Affinity Purification
Form/Format
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Concentration
1.11 mg/ml (lot specific)
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 481-660 of human CACNB2 (NP_963890.2).
Immunogen Sequence
ATSSLPLSPTLASNSQGSQGDQRTDRSAPIRSASQAEEEPSVEPVKKSQHRSSSSAPHHNHRSGTSRGLSRQETFDSETQESRDSAYVEPKEDYSHDHVDHYASHRDHNHRDETHGSSDHRHRESRHRSRDVDREQDHNECNKQRSRHKSKDRYCEKDGEVISKKRNEAGEWNRDVYIRQ
Positive Samples
Mouse Heart
Cellular Location
Cell Membrane, Cytoplasmic Side, Peripheral Membrane Protein, Sarcolemma
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.
Other Notes
Small volumes of anti-CACNB2 antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.
Related Product Information for
anti-CACNB2 antibody
This gene encodes a subunit of a voltage-dependent calcium channel protein that is a member of the voltage-gated calcium channel superfamily. The gene product was originally identified as an antigen target in Lambert-Eaton myasthenic syndrome, an autoimmune disorder. Mutations in this gene are associated with Brugada syndrome. Alternatively spliced variants encoding different isoforms have been described.
Applications Tested/Suitable for anti-CACNB2 antibody
Western Blot (WB), Immunohistochemistry (IHC)
Application Notes for anti-CACNB2 antibody
WB: 1:500-1:2000
IHC: 1:100-1:200
Western Blot (WB) of anti-CACNB2 antibody
Western blot-CACNB2 Polyclonal Antibody

NCBI/Uniprot data below describe general gene information for CACNB2. It may not necessarily be applicable to this product.
NCBI Accession #
NP_000715
[Other Products]
NCBI GenBank Nucleotide #
NP_000715.2
[Other Products]
UniProt Primary Accession #
Q08289
[Other Products]
UniProt Related Accession #
Q08289[Other Products]
Molecular Weight
Calculated: 64kDa; 65kDa; 68kDa; 69kDa; 70kDa; 71kDa; 73kDa
Observed: 90kDa
NCBI Official Full Name
voltage-dependent L-type calcium channel subunit beta-2 isoform 1
NCBI Official Synonym Full Names
calcium voltage-gated channel auxiliary subunit beta 2
NCBI Official Symbol
CACNB2??[Similar Products]
NCBI Official Synonym Symbols
MYSB; CAVB2; CACNLB2
??[Similar Products]
NCBI Protein Information
voltage-dependent L-type calcium channel subunit beta-2
UniProt Protein Name
Voltage-dependent L-type calcium channel subunit beta-2
UniProt Synonym Protein Names
Calcium channel voltage-dependent subunit beta 2; Lambert-Eaton myasthenic syndrome antigen B; MYSB
Protein Family
Voltage-dependent L-type calcium channel
UniProt Gene Name
CACNB2??[Similar Products]
UniProt Synonym Gene Names
CACNLB2; MYSB; CAB2; MYSB??[Similar Products]
UniProt Entry Name
CACB2_HUMAN
NCBI Summary for CACNB2
This gene encodes a subunit of a voltage-dependent calcium channel protein that is a member of the voltage-gated calcium channel superfamily. The gene product was originally identified as an antigen target in Lambert-Eaton myasthenic syndrome, an autoimmune disorder. Mutations in this gene are associated with Brugada syndrome. Alternatively spliced variants encoding different isoforms have been described. [provided by RefSeq, Feb 2013]
UniProt Comments for CACNB2
CACNB2: The beta subunit of voltage-dependent calcium channels contributes to the function of the calcium channel by increasing peak calcium current, shifting the voltage dependencies of activation and inactivation, modulating G protein inhibition and controlling the alpha-1 subunit membrane targeting. Defects in CACNB2 are the cause of Brugada syndrome type 4 (BRGDA4). A heart disease characterized by the association of Brugada syndrome with shortened QT intervals. Brugada syndrome is a tachyarrhythmia characterized by right bundle branch block and ST segment elevation on an electrocardiogram (ECG). It can cause the ventricles to beat so fast that the blood is prevented from circulating efficiently in the body. When this situation occurs (called ventricular fibrillation), the individual will faint and may die in a few minutes if the heart is not reset. Belongs to the calcium channel beta subunit family. 8 isoforms of the human protein are produced by alternative splicing.
Protein type: Channel, calcium
Chromosomal Location of Human Ortholog: 10p12
Cellular Component: integral to plasma membrane; voltage-gated calcium channel complex; sarcolemma
Molecular Function: voltage-gated calcium channel activity; protein binding; calcium channel activity; high voltage-gated calcium channel activity
Biological Process: synaptic transmission; axon guidance; visual perception; transport; positive regulation of calcium ion transport; neuromuscular junction development
Disease: Brugada Syndrome 4
Research Articles on CACNB2
1. This genotype/phenotype association study uncovered a variant in CACNB2 that may be associated with both KD susceptibility and bifid T waves, a novel signature of altered myocardial repolarization.
Precautions
All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.
Disclaimer
While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.
It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.