Product Name
Chymotrypsin C (CTRC), Polyclonal Antibody
Full Product Name
Chymotrypsin C antibody
Product Synonym Names
Polyclonal Chymotrypsin C; Anti-Chymotrypsin C; Caldecrin; CTRC; CLCR; ELA4
Product Gene Name
anti-CTRC antibody
[Similar Products]
Research Use Only
For Research Use Only. Not for use in diagnostic procedures.
Purity/Purification
Affinity purified
Form/Format
Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CTRC antibody in PBS
Concentration
1 mg/ml (lot specific)
Biological Significance
CTRC is a member of the peptidase S1 family. The protein is a serum calcium-decreasing factor that has chymotrypsin-like protease activity. Alternatively spliced transcript variants have been observed, but their full-length nature has not been determined. This gene encodes a member of the peptidase S1 family. The encoded protein is a serum calcium-decreasing factor that has chymotrypsin-like protease activity. Alternatively spliced transcript variants have been observed, but their full-length nature has not been determined.
Immunogen
Chymotrypsin C antibody was raised using a synthetic peptide corresponding to a region with amino acids LGITVLAALLACASSCGVPSFPPNLSARVVGGEDARPHSWPWQISLQYLK
Preparation and Storage
Store at 2-8 degree C for short periods. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Other Notes
Small volumes of anti-CTRC antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.
Related Product Information for
anti-CTRC antibody
Rabbit polyclonal Chymotrypsin C antibody
Product Categories/Family for anti-CTRC antibody
Proteases, Inhibitors, & Enzymes; Purified Polyclonal Antibodies
Applications Tested/Suitable for anti-CTRC antibody
Western Blot (WB)
Application Notes for anti-CTRC antibody
WB: 1 ug/ml
Western Blot (WB) of anti-CTRC antibody
Chymotrypsin C antibody (MBS5301094) used at 1 ug/ml to detect target protein.
NCBI/Uniprot data below describe general gene information for CTRC. It may not necessarily be applicable to this product.
NCBI Accession #
NP_009203.2
[Other Products]
NCBI GenBank Nucleotide #
NM_007272.2
[Other Products]
UniProt Secondary Accession #
O00765; Q9NUH5; A8K082[Other Products]
UniProt Related Accession #
Q99895[Other Products]
Molecular Weight
27 kDa (MW of target protein)[Similar Products]
NCBI Official Full Name
chymotrypsin-C preproprotein
NCBI Official Synonym Full Names
chymotrypsin C (caldecrin)
NCBI Official Symbol
CTRC??[Similar Products]
NCBI Official Synonym Symbols
CLCR; ELA4
??[Similar Products]
NCBI Protein Information
chymotrypsin-C
UniProt Protein Name
Chymotrypsin-C
UniProt Synonym Protein Names
Caldecrin
Protein Family
Chymotrypsin
UniProt Gene Name
CTRC??[Similar Products]
UniProt Synonym Gene Names
CLCR??[Similar Products]
UniProt Entry Name
CTRC_HUMAN
NCBI Summary for CTRC
This gene encodes a member of the peptidase S1 family. The encoded protein is a serum calcium-decreasing factor that has chymotrypsin-like protease activity. Alternatively spliced transcript variants have been observed, but their full-length nature has not been determined. [provided by RefSeq, Jul 2008]
UniProt Comments for CTRC
CTRC: Has chymotrypsin-type protease activity and hypocalcemic activity. Genetic variations in CTRC can predispose to chronic pancreatitis by diminishing its protective trypsin-degrading activity. Belongs to the peptidase S1 family. Elastase subfamily.
Protein type: Protease; EC 3.4.21.2
Chromosomal Location of Human Ortholog: 1p36.21
Molecular Function: peptidase activity; serine-type endopeptidase activity
Biological Process: proteolysis
Disease: Pancreatitis, Hereditary
Research Articles on CTRC
1. None of the selected 121 pancreatic cancer samples showed a pancreatitis-predisposing mutation in the CTRC gene.
Precautions
All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.
Disclaimer
While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.
It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.
