Product Name
FXN/Frataxin, Polyclonal Antibody
Popular Item
Full Product Name
[KO Validated] FXN/Frataxin Polyclonal Antibody
Product Synonym Names
[KO Validated] FXN Polyclonal Antibody; FXN; CyaY; FA; FARR; FRDA; X25; frataxin
Product Gene Name
anti-FXN antibody
[Similar Products]
Research Use Only
For Research Use Only. Not for use in diagnostic procedures.
3D Structure
ModBase 3D Structure for Q16595
Species Reactivity
Human, Mouse
Purity/Purification
Affinity Purification
Form/Format
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Concentration
2.28 mg/ml (lot specific)
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 42-210 of human FXN/Frataxin (NP_000135.2).
Immunogen Sequence
LRTDIDATCTPRRASSNQRGLNQIWNVKKQSVYLMNLRKSGTLGHPGSLDETTYERLAEETLDSLAEFFEDLADKPYTFEDYDVSFGSGVLTVKLGGDLGTYVINKQTPNKQIWLSSPSSGPKRYDWTGKNWVYSHDGVSLHELLAAELTKALKTKLDLSSLAYSGKDA
Positive Samples
K-562, U-87MG, Jurkat, Raji, DU-145, Mouse Kidney, Mouse Liver, Mouse Heart
Cellular Location
Cytoplasm, Mitochondrion
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.
Other Notes
Small volumes of anti-FXN antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.
Related Product Information for
anti-FXN antibody
This nuclear gene encodes a mitochondrial protein which belongs to the FRATAXIN family. The protein functions in regulating mitochondrial iron transport and respiration. The expansion of intronic trinucleotide repeat GAA from 8-33 repeats to >90 repeats results in Friedreich ataxia. Alternative splicing results in multiple transcript variants.
Applications Tested/Suitable for anti-FXN antibody
Western Blot (WB)
Application Notes for anti-FXN antibody
WB: 1:500-1:2000
Western Blot (WB) of anti-FXN antibody
Western blot-[KO Validated] FXN/Frataxin Polyclonal Antibody

Western Blot (WB) of anti-FXN antibody
Western blot-[KO Validated] FXN/Frataxin Polyclonal Antibody

NCBI/Uniprot data below describe general gene information for FXN. It may not necessarily be applicable to this product.
NCBI Accession #
Q16595.2
[Other Products]
UniProt Primary Accession #
Q16595
[Other Products]
UniProt Related Accession #
Q16595[Other Products]
Molecular Weight
Calculated: 19kDa; 21kDa; 23kDa
Observed: 14kDa
NCBI Official Full Name
Frataxin, mitochondrial
NCBI Official Synonym Full Names
frataxin
NCBI Official Symbol
FXN??[Similar Products]
NCBI Official Synonym Symbols
FA; X25; CyaY; FARR; FRDA
??[Similar Products]
NCBI Protein Information
frataxin, mitochondrial
UniProt Protein Name
Frataxin, mitochondrial
UniProt Synonym Protein Names
Friedreich ataxia protein; Fxn
UniProt Gene Name
FXN??[Similar Products]
UniProt Synonym Gene Names
FRDA; X25; Fxn; i-FXN??[Similar Products]
UniProt Entry Name
FRDA_HUMAN
NCBI Summary for FXN
This nuclear gene encodes a mitochondrial protein which belongs to the FRATAXIN family. The protein functions in regulating mitochondrial iron transport and respiration. The expansion of intronic trinucleotide repeat GAA from 8-33 repeats to >90 repeats results in Friedreich ataxia. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2016]
UniProt Comments for FXN
FXN: Promotes the biosynthesis of heme and assembly and repair of iron-sulfur clusters by delivering Fe(2+) to proteins involved in these pathways. May play a role in the protection against iron-catalyzed oxidative stress through its ability to catalyze the oxidation of Fe(2+) to Fe(3+); the oligomeric form but not the monomeric form has in vitro ferroxidase activity. May be able to store large amounts of iron in the form of a ferrihydrite mineral by oligomerization; however, the physiological relevance is unsure as reports are conflicting and the function has only been shown using heterologous overexpression systems. Modulates the RNA-binding activity of ACO1. Defects in FXN are the cause of Friedreich ataxia (FRDA). FRDA is an autosomal recessive, progressive degenerative disease characterized by neurodegeneration and cardiomyopathy it is the most common inherited ataxia. The disorder is usually manifest before adolescence and is generally characterized by incoordination of limb movements, dysarthria, nystagmus, diminished or absent tendon reflexes, Babinski sign, impairment of position and vibratory senses, scoliosis, pes cavus, and hammer toe. In most patients, FRDA is due to GAA triplet repeat expansions in the first intron of the frataxin gene. But in some cases the disease is due to mutations in the coding region. Belongs to the frataxin family. 2 isoforms of the human protein are produced by alternative splicing.
Protein type: Motility/polarity/chemotaxis; Mitochondrial; EC 1.16.3.1
Chromosomal Location of Human Ortholog: 9q21.11
Cellular Component: mitochondrion; mitochondrial matrix; cytosol
Molecular Function: 2 iron, 2 sulfur cluster binding; ferroxidase activity; protein binding; ferric iron binding; ferrous iron binding; iron-sulfur cluster binding
Biological Process: mitochondrion organization and biogenesis; negative regulation of multicellular organism growth; cellular iron ion homeostasis; positive regulation of metalloenzyme activity; positive regulation of transferase activity; proprioception; negative regulation of organ growth; positive regulation of cell growth; ***** walking behavior; protein autoprocessing; embryonic development ending in birth or egg hatching; iron incorporation into metallo-sulfur cluster; positive regulation of lyase activity; positive regulation of cell proliferation; aerobic respiration; ion transport; response to iron ion; negative regulation of apoptosis; positive regulation of oxidoreductase activity; oxidative phosphorylation; heme biosynthetic process
Disease: Friedreich Ataxia 1
Research Articles on FXN
1. Study reports 3.2 A resolution cryo-electron microscopy structure of the FXN-bound active human iron-sulfur clusters biosynthesis complex. FXN binds at the interface of two NFS1 and one ISCU subunits, modifying the local environment of a bound zinc ion that would otherwise inhibit NFS1 activity in complexes without FXN.
Precautions
All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.
Disclaimer
While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.
It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.