Product Name
Runt-related transcription factor 2 (RUNX2), Polyclonal Antibody
Full Product Name
Anti-RUNX2 Antibody
Product Synonym Names
Acute myeloid leukemia 3 protein antibody; Alpha subunit 1 antibody; AML3 antibody; CBF alpha 1 antibody; CBF-alpha-1 antibody; CBFA1 antibody; CCD antibody; CCD1 antibody; Cleidocranial dysplasia 1 antibody; Core binding factor antibody; Core binding factor runt domain alpha subunit 1 antibody; Core binding factor subunit alpha 1 antibody; Core-binding factor subunit alpha-1 antibody; MGC120022 antibody; MGC120023 antibody; Oncogene AML 3 antibody; Oncogene AML-3 antibody; OSF 2 antibody; OSF-2 antibody; OSF2 antibody; Osteoblast specific transcription factor 2 antibody; Osteoblast-specific transcription factor 2 antibody; OTTHUMP00000016533 antibody; PEA2 alpha A antibody; PEA2-alpha A antibody; PEA2aA antibody; PEBP2 alpha A antibody; PEBP2-alpha A antibody; PEBP2A1 antibody; PEBP2A2 antibody; PEBP2aA antibody; PEBP2aA antibody; PEBP2aA1 antibody; Polyomavirus enhancer binding protein 2 alpha A subunit antibody; Polyomavirus enhancer-binding protein 2 alpha A subunit antibody; Runt domain antibody; Runt related transcription factor 2 antibody; Runt-related transcription factor 2 antibody; RUNX2 antibody; RUNX2_HUMAN antibody; SL3 3 enhancer factor 1 alpha A subunit antibody; SL3-3 enhancer factor 1 alpha A subunit antibody; SL3/AKV core binding factor alpha A subunit antibody; SL3/AKV core-binding factor alpha A subunit antibody; runt-related transcription factor 2
Product Gene Name
anti-RUNX2 antibody
[Similar Products]
Research Use Only
For Research Use Only. Not for use in diagnostic procedures.
3D Structure
ModBase 3D Structure for Q13950
Species Reactivity
Human, Mouse. No cross reactivity with other proteins.
Purity/Purification
Immunogen affinity purified.
Form/Format
Lyophilized
Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg Thimerosal, 0.05mg NaN3.
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Immunogen
A synthetic peptide corresponding to a sequence in the middle region of human RUNX2(244-278aa DRLSDLGRIPHPSMRVGVPPQNPRPSLNSAPSPFN), identical to the related mouse sequence.
Preparation and Storage
At -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquotted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.
ISO Certification
Manufactured in an ISO 13485:2003 and EN ISO 13485:2012 Certified Laboratory.
Other Notes
Small volumes of anti-RUNX2 antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.
Related Product Information for
anti-RUNX2 antibody
Description: Rabbit IgG polyclonal antibody for Runt-related transcription factor 2(RUNX2) detection. Tested with WB in Human;Mouse.
Background: Core binding factor A1 (CBFA1/RUNX2) is a runt-like transcription factor essential for osteoblast differentiation. This protein is a member of the RUNX family of transcription factors and has a Runt DNA-binding domain. It is essential for osteoblastic differentiation and skeletal morphogenesis and acts as a scaffold for nucleic acids and regulatory factors involved in skeletal gene expression. RUNX2 plays a non-redundant role for Cbfa1 in tooth development that may be distinct from that in bone formation. In odontogenesis, RUNX2 is not involved in the early signaling networks regulating tooth initiation and early morphogenesis but regulates key epithelial-mesenchymal interactions that control advancing morphogenesis and histodifferentiation of the epithelial enamel organ.
Applications Tested/Suitable for anti-RUNX2 antibody
Western Blot (WB)
Application Notes for anti-RUNX2 antibody
Western Blot: Concentration: 0.1-0.5mug/ml; Tested Species: Human; Predicted Species: Mouse
Testing Data of anti-RUNX2 antibody
Anti-RUNX2 Picoband antibody, MBS177425-1.jpg
All lanes: Anti RUNX2 (MBS177425) at 0.5ug/ml
WB: Recombinant Human RUNX2 Protein 0.5ng
Predicted bind size: 50KD
Observed bind size: 50KD

Testing Data of anti-RUNX2 antibody
Anti-RUNX2 Picoband antibody, MBS177425-2.jpg
All lanes: Anti RUNX2 (MBS177425) at 0.5ug/ml
Lane 1: HELA Whole Cell Lysate at 40ug
Lane 2: A431 Whole Cell Lysate at 40ug
Lane 3: K562 Whole Cell Lysate at 40ug
Lane 4: JURKAT Whole Cell Lysate at 40ug
Predicted bind size: 56KD
Observed bind size: 62KD

NCBI/Uniprot data below describe general gene information for RUNX2. It may not necessarily be applicable to this product.
NCBI Accession #
NP_001015051.3
[Other Products]
NCBI GenBank Nucleotide #
NM_001015051.3
[Other Products]
UniProt Primary Accession #
Q13950
[Other Products]
UniProt Secondary Accession #
O14614; O14615; O95181[Other Products]
UniProt Related Accession #
Q13950[Other Products]
Molecular Weight
54,249 Da
NCBI Official Full Name
runt-related transcription factor 2 isoform b
NCBI Official Synonym Full Names
runt-related transcription factor 2
NCBI Official Symbol
RUNX2??[Similar Products]
NCBI Official Synonym Symbols
CCD; AML3; CCD1; CLCD; OSF2; CBFA1; OSF-2; PEA2aA; PEBP2aA; CBF-alpha-1
??[Similar Products]
NCBI Protein Information
runt-related transcription factor 2; PEA2-alpha A; PEBP2-alpha A; oncogene AML-3; acute myeloid leukemia 3 protein; SL3-3 enhancer factor 1 alpha A subunit; osteoblast-specific transcription factor 2; SL3/AKV core-binding factor alpha A subunit; core-binding factor, runt domain, alpha subunit 1; polyomavirus enhancer-binding protein 2 alpha A subunit
UniProt Protein Name
Runt-related transcription factor 2
UniProt Synonym Protein Names
Acute myeloid leukemia 3 protein; Core-binding factor subunit alpha-1; CBF-alpha-1; Oncogene AML-3; Osteoblast-specific transcription factor 2; OSF-2; Polyomavirus enhancer-binding protein 2 alpha A subunit; PEA2-alpha A; PEBP2-alpha A; SL3-3 enhancer factor 1 alpha A subunit; SL3/AKV core-binding factor alpha A subunit
Protein Family
Runt-related transcription factor
UniProt Gene Name
RUNX2??[Similar Products]
UniProt Synonym Gene Names
AML3; CBFA1; OSF2; PEBP2A; CBF-alpha-1; OSF-2; PEA2-alpha A; PEBP2-alpha A??[Similar Products]
UniProt Entry Name
RUNX2_HUMAN
NCBI Summary for RUNX2
This gene is a member of the RUNX family of transcription factors and encodes a nuclear protein with an Runt DNA-binding domain. This protein is essential for osteoblastic differentiation and skeletal morphogenesis and acts as a scaffold for nucleic acids and regulatory factors involved in skeletal gene expression. The protein can bind DNA both as a monomer or, with more affinity, as a subunit of a heterodimeric complex. Mutations in this gene have been associated with the bone development disorder cleidocranial dysplasia (CCD). Transcript variants that encode different protein isoforms result from the use of alternate promoters as well as alternate splicing. [provided by RefSeq, Jul 2008]
UniProt Comments for RUNX2
AML3: Transcription factor involved in osteoblastic differentiation and skeletal morphogenesis. Essential for the maturation of osteoblasts and both intramembranous and endochondral ossification. CBF binds to the core site, 5'- PYGPYGGT-3', of a number of enhancers and promoters, including murine leukemia virus, polyomavirus enhancer, T-cell receptor enhancers, osteocalcin, osteopontin, bone sialoprotein, alpha 1(I) collagen, LCK, IL-3 and GM-CSF promoters. In osteoblasts, supports transcription activation: synergizes with SPEN/MINT to enhance FGFR2-mediated activation of the osteocalcin FGF-responsive element (OCFRE). Inhibits KAT6B-dependent transcriptional activation. Interaction with SATB2 results in enhanced DNA binding and transactivation by these transcription factors. Heterodimer of an alpha and a beta subunit. Interacts with HIVEP3 and HIPK3. The alpha subunit binds DNA as a monomer and through the Runt domain. DNA-binding is increased by heterodimerization. Interacts with XRCC6 (Ku70) and XRCC5 (Ku80). Interacts with KAT6A and KAT6B. Binds to cyclin B1 CCNB1. Interacts with DDX5. Specifically expressed in osteoblasts. 3 isoforms of the human protein are produced by alternative splicing.
Protein type: Transcription factor; DNA-binding
Chromosomal Location of Human Ortholog: 6p21
Cellular Component: nucleoplasm; transcription factor complex; cytoplasm; nuclear chromatin
Molecular Function: protein domain specific binding; protein binding; bHLH transcription factor binding; chromatin binding; transcription factor activity; ATP binding
Biological Process: embryonic forelimb morphogenesis; transcription initiation from RNA polymerase II promoter; ossification; positive regulation of transcription, DNA-dependent; cell maturation; regulation of fibroblast growth factor receptor signaling pathway; stem cell differentiation; chondrocyte development; embryonic cranial skeleton morphogenesis; osteoblast development; odontogenesis of dentine-containing teeth; BMP signaling pathway; osteoblast differentiation; positive regulation of osteoblast differentiation; positive regulation of chondrocyte differentiation; negative regulation of smoothened signaling pathway; positive regulation of cell proliferation; gene expression; negative regulation of transcription, DNA-dependent; T cell differentiation; regulation of odontogenesis of dentine-containing teeth; endochondral ossification; osteoblast fate commitment
Disease: Metaphyseal Dysplasia With Maxillary Hypoplasia With Or Without Brachydactyly; Cleidocranial Dysplasia
Research Articles on RUNX2
1. On the basis of the structural analysis, study demonstrated that the p.R225Q mutation abolished DNA binding by RUNX2 suggesting that other genetic and/or environmental factors could affect the Cleidocranial dysplasia phenotypes.
Precautions
All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.
Disclaimer
While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.
It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.