Product Name
Ectodysplasin A (EDA), Polyclonal Antibody
Full Product Name
Ectodysplasin A antibody
Product Synonym Names
Polyclonal Ectodysplasin A; Anti-Ectodysplasin A; EDA1; EDA; ED1-A2; ED1-A1; ED1; HED; XLHED; XHED; EDA2
Product Gene Name
anti-EDA antibody
[Similar Products]
Research Use Only
For Research Use Only. Not for use in diagnostic procedures.
Species Reactivity
Human, Mouse
Specificity
Ectodysplasin A antibody was raised against the middle region of EDA
Purity/Purification
Affinity purified
Form/Format
Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of EDA antibody in PBS
Concentration
1 mg/ml (lot specific)
Biological Significance
EDA is a type II membrane protein that can be cleaved by furin to produce a secreted form. It belongs to the tumor necrosis factor family, acts as a homotrimer and may be involved in cell-cell signaling during the development of ectodermal organs. Defects in this gene are a cause of ectodermal dysplasia, anhidrotic, which is also known as X-linked hypohidrotic ectodermal dysplasia. Several transcript variants encoding many different isoforms have been found for this gene.
Immunogen
Ectodysplasin A antibody was raised using the middle region of EDA corresponding to a region with amino acids HLQGQGSAIQVKNDLSGGVLNDWSRITMNPKVFKLHPRSGELEVLVDGTY
Preparation and Storage
Store at 2-8 degree C for short periods. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Other Notes
Small volumes of anti-EDA antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.
Related Product Information for
anti-EDA antibody
Rabbit polyclonal Ectodysplasin A antibody raised against the middle region of EDA
Product Categories/Family for anti-EDA antibody
Signal Transduction; Purified Polyclonal Antibodies
Applications Tested/Suitable for anti-EDA antibody
Western Blot (WB)
Application Notes for anti-EDA antibody
WB: 1 ug/ml
Western Blot (WB) of anti-EDA antibody
Ectodysplasin A antibody (MBS5301032) used at 1 ug/ml to detect target protein.

NCBI/Uniprot data below describe general gene information for EDA. It may not necessarily be applicable to this product.
NCBI Accession #
AAI44052.1
[Other Products]
UniProt Secondary Accession #
O75910; Q5JS00; Q5JUM7; Q9UP77; Q9Y6L0; Q9Y6L1; Q9Y6L2; A0AUZ2; A2A337; B7ZLU2; B7ZLU4[Other Products]
UniProt Related Accession #
Q92838[Other Products]
Molecular Weight
41 kDa (MW of target protein)[Similar Products]
NCBI Official Full Name
Ectodysplasin A
NCBI Official Synonym Full Names
ectodysplasin A
NCBI Official Symbol
EDA??[Similar Products]
NCBI Official Synonym Symbols
ED1; HED; EDA1; EDA2; HED1; ODT1; XHED; ECTD1; XLHED; ED1-A1; ED1-A2; EDA-A1; EDA-A2; STHAGX1
??[Similar Products]
NCBI Protein Information
ectodysplasin-A
UniProt Protein Name
Ectodysplasin-A
UniProt Synonym Protein Names
Ectodermal dysplasia protein; EDA protein
Protein Family
Ectodysplasin
UniProt Gene Name
EDA??[Similar Products]
UniProt Synonym Gene Names
ED1; EDA2; EDA protein??[Similar Products]
UniProt Entry Name
EDA_HUMAN
NCBI Summary for EDA
The protein encoded by this gene is a type II membrane protein that can be cleaved by furin to produce a secreted form. The encoded protein, which belongs to the tumor necrosis factor family, acts as a homotrimer and may be involved in cell-cell signaling during the development of ectodermal organs. Defects in this gene are a cause of ectodermal dysplasia, anhidrotic, which is also known as X-linked hypohidrotic ectodermal dysplasia. Several transcript variants encoding many different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]
UniProt Comments for EDA
EDA: Seems to be involved in epithelial-mesenchymal signaling during morphogenesis of ectodermal organs. Isoform 1 binds only to the receptor EDAR, while isoform 3 binds exclusively to the receptor XEDAR. Defects in EDA are the cause of ectodermal dysplasia type 1 (ED1); also known as Christ-Siemens-Touraine syndrome or X-linked hypohidrotic ectodermal dysplasia (XLHED). Ectodermal dysplasia defines a heterogeneous group of disorders due to abnormal development of two or more ectodermal structures. ED1 is a disease characterized by sparse hair (atrichosis or hypotrichosis), abnormal or missing teeth and the inability to sweat due to the absence of sweat glands. ED1 is the most common form of over 150 clinically distinct ectodermal dysplasias. Defects in EDA are the cause of tooth agenesis selective X-linked type 1 (STHAGX1). A form of selective tooth agenesis, a common anomaly characterized by the congenital absence of one or more teeth. Selective tooth agenesis without associated systemic disorders has sometimes been divided into 2 types: oligodontia, defined as agenesis of 6 or more permanent teeth, and hypodontia, defined as agenesis of less than 6 teeth. The number in both cases does not include absence of third molars (wisdom teeth). Belongs to the tumor necrosis factor family. 8 isoforms of the human protein are produced by alternative splicing.
Protein type: Receptor, misc.; Motility/polarity/chemotaxis; Membrane protein, integral
Chromosomal Location of Human Ortholog: Xq12-q13.1
Cellular Component: endoplasmic reticulum membrane; collagen; cytoskeleton; intracellular membrane-bound organelle; membrane; apical part of cell; integral to plasma membrane; plasma membrane; integral to membrane; extracellular region
Molecular Function: protein binding; tumor necrosis factor receptor binding; receptor binding
Biological Process: pigmentation; cell-matrix adhesion; ectoderm development; immune response; positive regulation of NF-kappaB import into nucleus; gene expression; cell differentiation; signal transduction; odontogenesis of dentine-containing teeth; activation of NF-kappaB transcription factor
Disease: Tooth Agenesis, Selective, X-linked, 1; Ectodermal Dysplasia 1, Hypohidrotic, X-linked
Research Articles on EDA
1. novel non-synonymous mutation in ectodysplasin A (EDA) associated with non-syndromic X-linked dominant congenital tooth agenesis
Precautions
All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.
Disclaimer
While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.
It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.