Product Name
SLC26A9, Polyclonal Antibody
Full Product Name
SLC26A9 antibody
Product Synonym Names
Polyclonal SLC26A9; Anti-SLC26A9; SLC26A9; Solute Carrier Family 26 Member 9; SLCA9-26; SLCA9 26
Product Gene Name
anti-SLC26A9 antibody
[Similar Products]
Research Use Only
For Research Use Only. Not for use in diagnostic procedures.
Specificity
SLC26A9 antibody was raised against the middle region of SLC26A9
Purity/Purification
Affinity purified
Form/Format
Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SLC26A9 antibody in PBS
Concentration
1 mg/ml (lot specific)
Biological Significance
This gene is one member of a family of sulfate/anion transporter genes. Family members are well conserved in their genomic (number and size of exons) and protein (aa length among species) structures yet have markedly different tissue expression patterns.
Immunogen
SLC26A9 antibody was raised using the middle region of SLC26A9 corresponding to a region with amino acids LAKLSSTYGKIGVKVFLVNIHAQVYNDISHGGVFEDGSLECKHVFPSIHD
Preparation and Storage
Store at 2-8 degree C for short periods. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Other Notes
Small volumes of anti-SLC26A9 antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.
Related Product Information for
anti-SLC26A9 antibody
Rabbit polyclonal SLC26A9 antibody raised against the middle region of SLC26A9
Product Categories/Family for anti-SLC26A9 antibody
Cell Biology; Purified Polyclonal Antibodies
Applications Tested/Suitable for anti-SLC26A9 antibody
Western Blot (WB)
Application Notes for anti-SLC26A9 antibody
WB: 1 ug/ml
Western Blot (WB) of anti-SLC26A9 antibody
SLC26A9 antibody (MBS5300890) used at 1 ug/ml to detect target protein.
NCBI/Uniprot data below describe general gene information for SLC26A9. It may not necessarily be applicable to this product.
NCBI Accession #
NP_443166.1
[Other Products]
NCBI GenBank Nucleotide #
NM_052934.3
[Other Products]
UniProt Secondary Accession #
Q96PK9; Q96RN0; A7E2V6; B1AVM8; B1AVM9; B7ZKK2[Other Products]
UniProt Related Accession #
Q7LBE3[Other Products]
Molecular Weight
87 kDa (MW of target protein)
NCBI Official Full Name
solute carrier family 26 member 9 isoform a
NCBI Official Synonym Full Names
solute carrier family 26 (anion exchanger), member 9
NCBI Official Symbol
SLC26A9??[Similar Products]
NCBI Protein Information
solute carrier family 26 member 9
UniProt Protein Name
Solute carrier family 26 member 9
UniProt Synonym Protein Names
Anion transporter/exchanger protein 9
Protein Family
Solute carrier family
UniProt Gene Name
SLC26A9??[Similar Products]
UniProt Entry Name
S26A9_HUMAN
NCBI Summary for SLC26A9
This gene is one member of a family of sulfate/anion transporter genes. Family members are well conserved in their genomic (number and size of exons) and protein (aa length among species) structures yet have markedly different tissue expression patterns. The product of this gene is a highly selective chloride ion channel regulated by WNK kinases. Alternative splicing results in multiple transcript variants encoding differing isoforms.[provided by RefSeq, Dec 2008]
UniProt Comments for SLC26A9
SLC26A9: DIDS- and thiosulfate- sensitive anion exchanger mediating chloride, sulfate and oxalate transport. Mediates chloride/bicarbonate exchange or chloride-independent bicarbonate extrusion thus assuring bicarbonate secretion. Inhibited by ammonium and thiosulfate. Belongs to the SLC26A/SulP transporter (TC 2.A.53) family.
Protein type: Transporter; Membrane protein, integral; Membrane protein, multi-pass; Transporter, SLC family
Chromosomal Location of Human Ortholog: 1q32.1
Cellular Component: cell surface; apical plasma membrane; plasma membrane; integral to membrane
Molecular Function: bicarbonate transmembrane transporter activity; chloride channel activity; anion:anion antiporter activity; secondary active sulfate transmembrane transporter activity; ATPase binding
Biological Process: bicarbonate transport; regulation of pH; chloride transport; ion transport; transmembrane transport; anion transport
Research Articles on SLC26A9
1. SLC26A9 single nucleotide polymorphisms modify prenatal exocrine pancreatic damage in cystic fibrosis
Precautions
All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.
Disclaimer
While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.
It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.
